PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0011s0291.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family B3
Protein Properties Length: 572aa    MW: 64758.8 Da    PI: 5.3154
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0011s0291.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3391.4e-1216100899
                          -HHHHTT-EE--HHH.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
                   B3   8 sdvlksgrlvlpkkfaeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                           ++++ + l +p  f e++ +g + +++   l++ ++ + W+v +   +++    + +GW eF++a++Lk+g f+v+k+dg + f  +v+
  Kaladp0011s0291.1.p  16 LHNFAAN-LAIPVAFYEKYlEGRPGCGTRAELRSrLRRQGWKVGM--VGRR----IVDGWAEFADAHELKVGYFLVIKYDGGTVF--HVS 96 
                          4556655.9***********9999**********778899*****..7777....889*********************998888..*** PP

                          EE-S CS
                   B3  96 vfrk 99 
                          vf++
  Kaladp0011s0291.1.p  97 VFDT 100
                          *997 PP

2B349.38.7e-161452171690
                          EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
                   B3  16 lvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                          l +p  f+ +++++  +s +++++de g++W vk++ +k++++++  +GW++Fv+ ngL+ gD + F+ ++ +++
  Kaladp0011s0291.1.p 145 LHFPACFCVANKLNVSCS-EIIVKDEAGKVWPVKVKCKKGGNAVYTMGGWRSFVEGNGLQKGDRFNFRIVS-KGK 217
                          558999*****9998887.****************9999999999999********************765.343 PP

3B337.93.3e-123514311598
                          -EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                   B3  15 rlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                           l++p  f +++++++ +  ++ +ed +g+ W vk++ +++ + ++  +GW +F + ng++ gD   F++++  ++++v++++r
  Kaladp0011s0291.1.p 351 SLYFPVYFSRANNLDS-C-SEIDVEDDRGKLWPVKIRLKRNTNLVYTVGGWTSFIRGNGIRKGDRYEFRVIS-YGTKPVLSFRR 431
                          4789999999999993.4.49***************99999999999**********************987.67778877765 PP

4B348.81.3e-15471563697
                          ..-HHHHTT-EE--HHH.HTT...---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
                   B3   6 tpsdvlksgrlvlpkkfaeeh...ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                          ++  +l ++rl l  +fa+ +   +    +s +++l++++g+sW  +l+ +++s+r+++t+GW eF+ angL++g ++ +++++ +++ l
  Kaladp0011s0291.1.p 471 ITQASLDRSRLFLGINFAKMNglaD--RDRSGDMILRNSQGKSWVATLKREGNSSRFFITSGWTEFALANGLEAGRVFRLEVVEPESKLL 558
                          4566778889***********7533..347779****************9*****************************99887666656 PP

                          EEEEE CS
                   B3  93 vvkvf 97 
                          ++k+ 
  Kaladp0011s0291.1.p 559 TLKLT 563
                          66665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.1E-135103IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.73E-155107IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.6578101IPR003340B3 DNA binding domain
CDDcd100171.75E-13999No hitNo description
SMARTSM010192.7E-1211101IPR003340B3 DNA binding domain
PfamPF023621.9E-820100IPR003340B3 DNA binding domain
SuperFamilySSF1019368.83E-17126224IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.7E-15128224IPR015300DNA-binding pseudobarrel domain
CDDcd100173.14E-14132225No hitNo description
SMARTSM010191.1E-13133227IPR003340B3 DNA binding domain
PfamPF023626.8E-14143222IPR003340B3 DNA binding domain
PROSITE profilePS5086312.041163226IPR003340B3 DNA binding domain
SuperFamilySSF1019362.16E-14335432IPR015300DNA-binding pseudobarrel domain
CDDcd100172.61E-12337431No hitNo description
Gene3DG3DSA:2.40.330.101.8E-11337437IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.914337432IPR003340B3 DNA binding domain
SMARTSM010191.3E-11344433IPR003340B3 DNA binding domain
PfamPF023622.0E-10351431IPR003340B3 DNA binding domain
CDDcd100172.44E-13465557No hitNo description
SuperFamilySSF1019361.84E-15466558IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.014466566IPR003340B3 DNA binding domain
SMARTSM010192.8E-14467566IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.4E-13468560IPR015300DNA-binding pseudobarrel domain
PfamPF023626.5E-14470565IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 572 aa     Download sequence    Send to blast
MANPSPKIPH FFQPLLHNFA ANLAIPVAFY EKYLEGRPGC GTRAELRSRL RRQGWKVGMV  60
GRRIVDGWAE FADAHELKVG YFLVIKYDGG TVFHVSVFDT SACEVEYGDE HDEDDAVEGD  120
GEELKMDSGQ TSYVGTLRPS YLISLHFPAC FCVANKLNVS CSEIIVKDEA GKVWPVKVKC  180
KKGGNAVYTM GGWRSFVEGN GLQKGDRFNF RIVSKGKIPV LSFHRIGMRD QTEVATRAKR  240
RKAAEVPELV TSAGEVEHPS LDEDEHDNVE QDDEEDTVEE DDDEDLSEED YEEEDMVKED  300
YDKEEDMVDG DDEEHKTELD HSRKRMKNRN PATDDSTASY VGTMCRAYLT SLYFPVYFSR  360
ANNLDSCSEI DVEDDRGKLW PVKIRLKRNT NLVYTVGGWT SFIRGNGIRK GDRYEFRVIS  420
YGTKPVLSFR RIGPKHKAAL EEEEKVPELA LRHFEKTTGS LIPGKYLIRT ITQASLDRSR  480
LFLGINFAKM NGLADRDRSG DMILRNSQGK SWVATLKREG NSSRFFITSG WTEFALANGL  540
EAGRVFRLEV VEPESKLLTL KLTRRVTLED L*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1322328RKRMKNR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31640.14e-39B3 family protein